IGF-1LR3 1mg
₡ 72,011
IGF-1LR3 1mg is a premium research peptide studied for muscle growth and metabolic pathways. It is researched for IGF-1 receptor activity, cellular development, and recovery studies. Supplied as a high-quality research compound for professional use.
- Verified COA Available
Product Information
IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) is a modified version of naturally occurring IGF-1, designed with a longer half-life and reduced binding to IGF-binding proteins. This structural enhancement allows it to remain active in the body for a significantly extended period, increasing its overall effectiveness compared to standard IGF-1.
Unlike HGH, which stimulates the body to produce IGF-1 indirectly, IGF-1 LR3 acts more directly on muscle and cellular receptors. It plays a central role in promoting cell growth, differentiation, and regeneration. This makes it particularly relevant for individuals focused on lean muscle development, as it supports the creation of new muscle cells rather than only enhancing the size of existing ones.
IGF-1 LR3 also enhances nutrient partitioning, meaning the body becomes more efficient at directing nutrients such as amino acids and glucose into muscle tissue. This can contribute to improved muscle fullness, recovery, and overall performance output.
Another key aspect of IGF-1 LR3 is its ability to support recovery at a cellular level. By encouraging tissue repair and regeneration, it may help reduce downtime between workouts and support consistent training intensity.
| IGF-1LR3 1mg — Technical Specifications | |
| Specification | Value |
| Product Name: | IGF-1LR3 1mg |
| Compound Type: | Synthetic IGF-1 analogue, 83 aa, Arg3-modified |
| CAS Number: | 143045-27-6 |
| Molecular Formula: | C400H625N111O115S9 |
| Molecular Weight (g/mol): | 9117.60 |
| Amino Acid Count: | 83 |
| Amino Acid Sequence: | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Synonyms / Other Names: | Long R3-IGF-1, IGF-1 Long R3, LR3-IGF-1, Insulin-like Growth Factor-1 LR3 |
| Appearance: | White to off-white lyophilized powder |
| Purity: | ≥99% (HPLC) |
| Solubility: | Soluble in 10 mM HCl (0.1–1 mg/mL); reconstitute in bacteriostatic water |
| Storage (Sealed): | Freeze ≤ −20 °C, sealed, away from light & moisture; stable ~24 months |
| Storage (After Reconstitution): | Refrigerate 2–8 °C; use within 28–30 days; avoid repeated freeze-thaw |
Specification
Value
Product Name:
N/A
Compound Type:
N/A
CAS Number:
N/A
PubChem CID:
N/A
Molecular Formula:
N/A
Molecular Weight (g/mol):
N/A
Amino Acid Count:
N/A
Amino Acid Sequence:
N/A
Synonyms / Other Names:
N/A
Appearance:
N/A
Purity:
N/A
Solubility:
N/A
Storage — Sealed:
N/A
Storage — After Reconstitution:
N/A
Why Choose Peptides Costa Rica?
We specialize in supplying high-purity research peptides with a focus on transparency, fast domestic delivery, and dedicated customer support.
What You Get
IGF-1 LR3 1mg delivers targeted support for muscle growth, recovery, and metabolic efficiency through its long-lasting anabolic activity.
Ordering from us, you will get:
- 1 x IGF-1 LR3 vial (1mg)
- Long-acting, high-purity peptide formulation
- Secure packaging designed for peptide stability
- Clearly labeled vial for accurate identification
IGF-1 LR3 directly supports muscle cell growth and differentiation, making it highly effective for promoting lean muscle development. It goes beyond traditional support by encouraging the formation of new muscle cells, contributing to long-term physical progression.
By accelerating cellular repair processes, IGF-1 LR3 helps reduce recovery time between workouts. This allows for more consistent training, improved endurance, and better overall performance during high-intensity routines.
IGF-1 LR3 improves how the body utilizes nutrients, directing them more effectively into muscle tissue. This supports better muscle fullness, optimized energy use, and improved body composition when combined with proper nutrition.
You May Also Like
Ordering Peptides in Costa Rica
Peptides Costa Rica serves customers only within Costa Rica.
To place an order:
Review product availability and pricing.
Contact us directly to confirm current stock.
Complete payment using one of the following methods:
• Card Payment via Shield Hub Pay
• Cash
We arrange delivery within Costa Rica. Now get easy online checkout with all the given payment options. Simply add your preferred product in cart and place your order. We also handle orders directly to make sure your items are available before you pay.
Customer Reviews
Insights and experiences from from our growing community of satisfied customers.
IGF-1LR3 1mg
Sorry, no reviews match your current selections
Trusted Source Section
We provide high-quality research compounds with a focus on purity, consistency, and transparency. All products are carefully sourced, reliably handled, and supported with fast delivery across Costa Rica.
Bulk Savings
Save more with bulk purchases. Buy five or more vials of the same product and get 15% off with clear, upfront pricing and no hidden conditions.
Simple Ordering Process
Place orders through a simple process—review products, confirm availability, choose your payment method, and arrange delivery within Costa Rica.
Flexible Payment Options
Choose from secure payment options including SINPE Móvil, Zelle, or cash for smooth and convenient transactions.
Transparency & Documentation
We provide Certificates of Analysis along with clear communication, verified stock, and straightforward pricing for complete trust.
