VIP 5
VIP-5 is vasoactive intestinal peptide (VIP), a synthetic [28-amino-acid peptide], supplied in Costa Rica as a 5 mg freeze-dried powder for laboratory research, with a certificate of analysis for every batch. This research compound is investigated within laboratory models focusing on peptide biology and cellular communication.
Buy VIP-5 Peptide: Research Grade & Lab Tested
VIP-5 is a synthetic peptide fragment derived from research involving vasoactive intestinal peptide (VIP) pathways. It is studied in laboratory environments focusing on peptide characteristics, molecular interactions, and receptor-related research.
At Peptides Costa Rica, VIP-5 is provided as a research compound with detailed product information, quality-focused documentation, and organized specifications for customers reviewing peptide materials.
Researchers studying VIP-related compounds use VIP-5 as a reference material for exploring peptide structures, signaling pathways, and molecular research models.
VIP-5 Price in Costa Rica
At Peptides Costa Rica, VIP-5 is available with transparent pricing and a simple ordering process for customers looking for research-grade peptide compounds.
Our product information includes:
▸ Clear peptide specifications
▸ Research-focused documentation
▸ Secure purchasing process
▸ Product handling information
VIP-5 is supplied with organized details to support researchers reviewing peptide characteristics and available information.
What VIP-5 Is, and What the Research Record Shows
Studies exploring VIP-5 have focused on its peptide structure, molecular characteristics, and relationship with vasoactive intestinal peptide-related research pathways. Researchers have documented the following areas of interest:
Structure and Identity
VIP-5 is a synthetic peptide fragment associated with research involving vasoactive intestinal peptide (VIP) systems. It is studied as a short peptide compound with a defined amino acid structure and molecular characteristics. Research evaluations of VIP-related peptides focus on peptide composition, structural properties, and interactions within controlled laboratory environments. The identity and specifications of VIP-5 depend on the exact research material and product documentation provided.
Origin and Development
VIP-related peptide research originated from studies investigating neuropeptides and their role in molecular signaling pathways. Synthetic peptide fragments such as VIP-5 were developed through advances in peptide chemistry, allowing researchers to examine specific peptide structures and their interactions in laboratory research models.
Pathway Described in the Literature
Published research involving vasoactive intestinal peptide pathways has examined peptide-receptor interactions, molecular signaling mechanisms, and cellular communication processes. VIP-related studies explore how peptide compounds interact with biological systems in controlled research environments, helping researchers understand molecular pathways associated with neuropeptide research.
Strength of the Evidence
Available research on VIP-related compounds includes laboratory investigations examining peptide structure, receptor interactions, and molecular characteristics. Research findings depend on experimental models, testing methods, and study conditions. VIP-5 is provided as a research compound, and evaluation should be based on available scientific information and product documentation.
Why Choose Peptides Costa Rica's VIP-5?
We specialize in supplying high-purity research peptides with a focus on transparency, fast domestic delivery, and dedicated customer support.
VIP-5 Research Overview
VIP-5 is a synthetic peptide associated with research involving vasoactive intestinal peptide (VIP) pathways. VIP-related peptides have been studied for their molecular structure, receptor interactions, and role in peptide signaling research.
Scientific investigations involving VIP compounds focus on understanding peptide-receptor interactions, cellular communication mechanisms, and laboratory research models.
With its defined peptide structure, VIP-5 serves as a reference compound for researchers exploring peptide biology and molecular pathways.
What You Receive
Focused on brain performance and resilience, Explore VIP-5 is widely explored for its role in cognition and recovery.
01
Documented Identity
Sequence, purity figure and batch number stated on the Certificate of Analysis.
02
Tested Purity
HPLC purity with chromatogram, plus identity confirmation by mass spectrometry.
03
Defined Handling
Lyophilised powder, 5mg vial, stored 2–8°C, freezer for long-term storage.
04
Consistent Supply
Trusted Source for Research Peptides
We supply high-purity Adamax and other research peptides with a focus on consistent quality, transparent pricing, and reliable local delivery. Every order ships from inside Costa Rica, so you avoid the customs delays, import duties, and uncertainty that come with international peptide purchases.
Bulk Savings
Save more with bulk purchases. Buy five or more vials of the same product and get 15% off with clear, upfront pricing and no hidden conditions.
Simple Ordering Process
Place orders through a simple process—review products, confirm availability, choose your payment method, and arrange delivery within Costa Rica.
Flexible Payment Options
Choose from secure payment options including SINPE Móvil, Zelle, or cash for smooth and convenient transactions.
Transparency & Documentation
We provide Certificates of Analysis along with clear communication, verified stock, and straightforward pricing for complete trust.
Frequently Asked Questions
Here are answers to the most common questions about VIP-5 pricing, storage, research applications, and delivery in Costa Rica.
VIP-5 is vasoactive intestinal peptide, a synthetic peptide of [28] amino acids with the sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2. The "5" in the name refers to the 5 mg vial. We supply it in Costa Rica as a freeze-dried powder, independently tested for every batch, for laboratory research only.
The price of VIP-5 depends on the available product size and current product listing information.
VIP-5 belongs to the synthetic peptide research category.
VIP-5 has a specific peptide structure and research classification that differs from other peptide compounds based on molecular characteristics.
Customers interested in larger quantities can contact our team for available bulk purchasing options.
Yes. Vasoactive intestinal peptide has the CAS number 40077-57-4, the molecular formula C147H238N44O42S and a molecular weight of about 3,326 g/mol. The batch certificate of analysis should show the same identity, plus the purity result and mass confirmation for your vial.
Shipping availability depends on location and current ordering options.
Storage should follow the product documentation and recommended laboratory handling guidelines.
